PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG040945t1
Common NameTCM_040945
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family HB-other
Protein Properties Length: 591aa    MW: 66536.5 Da    PI: 8.443
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG040945t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.42.5e-1851106257
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                       +kRt  t+ q+ +Le++++++r ps e++++LA++++Lte+q++ WF+ rR k+k+
  Thecc1EG040945t1  51 KKRTVKTPAQVMALENFYKEHRFPSDEMKAQLAAQIRLTEKQISSWFCHRRLKDKR 106
                       8*****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.1E-1938107IPR009057Homeodomain-like
SuperFamilySSF466897.7E-1745107IPR009057Homeodomain-like
PROSITE profilePS5007116.29347107IPR001356Homeobox domain
SMARTSM003896.2E-1849111IPR001356Homeobox domain
CDDcd000862.26E-1751107No hitNo description
PfamPF000465.5E-1651106IPR001356Homeobox domain
PROSITE patternPS00027082105IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 591 aa     Download sequence    Send to blast
MDFFVRNDSK IPESVVTGGT PKNERYQEDI ACEYSAEVQT EENKVSLDVN KKRTVKTPAQ  60
VMALENFYKE HRFPSDEMKA QLAAQIRLTE KQISSWFCHR RLKDKRRDES YANGRQDHSS  120
GVIQDRGSGL RQDSCGSIKQ GDYRNVDPRE VESRRIYGHD FPVADLTYER RSHQNPYNAH  180
MEDTSSESSS SLHDQRFSES RDPYDMQISA NLTQNGAITQ IKPRIVKSMG YKPSGYLKVK  240
GEMENPAVTA VKRQLGSHYQ EDGPLLGIEF DPLPPGAFEF RSSNLVNEPI YVGDPRQEHS  300
PDISGVIKQP NLNIINEVHN PKMSSQASYM EDANLNTEHG SDRQDRKSHH QLKYKSSFLC  360
SNPFPGQNSS INVYESSAGK TAVSDCKRSR MSFKPAVERM GSDSFSNQPG PYGSKIANEQ  420
EKPWLHDDDN HTYKAPKNEN LSKTSDLIHG CSESLGTERG PSARMGKLEK LGGEWKPKRE  480
YPVRENIDPT NELKVAKRVK VEFPQQNFVA NASHSRSLLL TNPTKGGAIS VVFIFVKCIA  540
LARHLGKVIR QITIHLVILC PFISRKFEAA SGMLALNSLN FEENFSCKAP *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
199107RRLKDKRRD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007015307.10.0Homeodomain-like superfamily protein, putative isoform 1
TrEMBLA0A061GTU20.0A0A061GTU2_THECC; Homeodomain-like superfamily protein, putative isoform 1
STRINGPOPTR_0009s07600.11e-160(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122022531
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.12e-87HB-other family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]